LY6E Recombinant Protein

• Gene Name:

  Lymphocyte antigen 6 family member E

• Gene Aliases:

  Ly-6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; retinoic acid-induced gene E protein; RIGE; RIG-E; SCA2; SCA-2; stem cell antigen 2; thymic shared antigen 1; TSA-1.

• Gene ID:

  4061

• Reactivity:

  Homo sapiens|Human

• Target:

  Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

• Purification:

  Affinity purified using IMAC

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  24.5 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  LY6E

• Host or Source:

  Human

• Protein Name:

  Lymphocyte antigen 6E

• Gene Name URL:

  LY6E

• CAS Number:

  9000-83-3