CXCR4 Recombinant Protein (Human)

CAT:
247-OPCA05092-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CXCR4 Recombinant Protein (Human) - image 1

CXCR4 Recombinant Protein (Human)

  • Gene Name:

    C-X-C motif chemokine receptor 4
  • Gene Aliases:

    CD184; CD184 antigen; chemokine (C-X-C motif) receptor 4; C-X-C chemokine receptor type 4; D2S201E; FB22; fusin; HM89; HSY3RR; LAP3; LAP-3; LCR1; LESTR; leukocyte-derived seven transmembrane domain receptor; lipopolysaccharide-associated protein 3; LPS-associated protein 3; neuropeptide Y receptor Y3; neuropeptide Y3 receptor; NPY3R; NPYR; NPYRL; NPYY3R; SDF-1 receptor; seven transmembrane helix receptor; seven-transmembrane-segment receptor, spleen; stromal cell-derived factor 1 receptor; WHIM; WHIMS; WHIMS1.
  • Gene ID:

    7852
  • Accession Number:

    NP_001008540
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
  • Purification:

    Affinity purified using IMAC
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    25.2 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    CXCR4
  • Protein Name:

    C-X-C chemokine receptor type 4
  • Gene Name URL:

    CXCR4
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001008540