UBE2F Recombinant Protein (Human)

• Gene Name:

  Ubiquitin conjugating enzyme E2 F (putative)

• Gene Aliases:

  NCE2; NEDD8 carrier protein UBE2F; NEDD8 protein ligase UBE2F; NEDD8-conjugating enzyme 2; NEDD8-conjugating enzyme UBE2F; RING-type E3 NEDD8 transferase UBE2F; Ubiquitin-conjugating enzyme E2 F; ubiquitin-conjugating enzyme E2F (putative) .

• Gene ID:

  140739

• Accession Number:

  NP_001265234

• Reactivity:

  Homo sapiens|Human

• Target:

  Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  48.1 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  UBE2F

• Protein Name:

  NEDD8-conjugating enzyme UBE2F

• Gene Name URL:

  UBE2F

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001278305