ARPC5 Recombinant Protein (Human)

• Gene Name:

  Actin related protein 2/3 complex subunit 5

• Gene Aliases:

  Actin related protein 2/3 complex, subunit 5, 16kDa; actin-related protein 2/3 complex subunit 5; ARC16; arp2/3 complex 16 kDa subunit; Arp2/3 protein complex subunit p16; dJ127C7.3; p16-Arc.

• Gene ID:

  10092

• Accession Number:

  NP_001257368

• Reactivity:

  Homo sapiens|Human

• Target:

  Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  43.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  ARPC5

• Protein Name:

  Actin-related protein 2/3 complex subunit 5

• Gene Name URL:

  ARPC5

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001270439