PEA15 Recombinant Protein (Human)

• Gene Name:

  Proliferation and apoptosis adaptor protein 15

• Gene Aliases:

  15 kDa phosphoprotein enriched in astrocytes; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT-1 oncogene; HUMMAT1H; mammary transforming gene 1, mouse, homolog of; MAT1; MAT1H; PEA-15; PED; PED/PEA15; PED-PEA15; phosphoprotein enriched in astrocytes 15; phosphoprotein enriched in diabetes; proliferation and apoptosis adaptor 15.

• Gene ID:

  8682

• Accession Number:

  NP_001284505

• Reactivity:

  Homo sapiens|Human

• Target:

  Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity) . Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  42 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  PEA15

• Protein Name:

  Astrocytic phosphoprotein PEA-15

• Gene Name URL:

  PEA15

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001297576