CDKN2D Recombinant Protein (Human)

• Gene Name:

  Cyclin dependent kinase inhibitor 2D

• Gene Aliases:

  CDK inhibitor p19INK4d; cell cycle inhibitor, Nur77 associating protein; cyclin-dependent kinase 4 inhibitor D; cyclin-dependent kinase 4 inhibitor D p19; cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) ; inhibitor of cyclin-dependent kinase 4d; INK4D; p19; p19-INK4D.

• Gene ID:

  1032

• Accession Number:

  NP_001791

• Reactivity:

  Homo sapiens|Human

• Target:

  Interacts strongly with CDK4 and CDK6 and inhibits them.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  44.7 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  CDKN2D

• Protein Name:

  Cyclin-dependent kinase 4 inhibitor D

• Gene Name URL:

  CDKN2D

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001800