ERAP1 Recombinant Protein (Mouse)

CAT:
247-OPCA04658-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ERAP1 Recombinant Protein (Mouse) - image 1

ERAP1 Recombinant Protein (Mouse)

  • CAS Number :

    9000-83-3
  • Gene Name :

    Endoplasmic reticulum aminopeptidase 1
  • Gene Aliases :

    Adipocyte-derived leucine aminopeptidase; A-LAP; aminopeptidase PILS; Ar; Arts1; ARTS-1; E; endoplasmic reticulum aminopeptidase 1; ERAAP; PILSA; PILSAP; puromycin-insensitive leucyl-specific aminopeptidase; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; VEGF-induced aminopeptidase.
  • Gene ID :

    80898
  • Accession Number :

    NP_109636
  • Reactivity :

    Mouse|Mus musculus
  • Target :

    Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity) .
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    28.3 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    Erap1
  • Protein Name :

    Endoplasmic reticulum aminopeptidase 1
  • Gene Name URL :

    Erap1
  • Nucleotide Accession Number :

    NM_030711

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide