Complement C3 , partial Recombinant Protein (Rat)

CAT:
247-OPCA04592-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Complement C3 , partial Recombinant Protein (Rat) - image 1

Complement C3 , partial Recombinant Protein (Rat)

  • Gene Name :

    Complement C3
  • Gene Aliases :

    Complement C3; complement component 3.
  • Gene ID :

    24232
  • Accession Number :

    NP_058690
  • Reactivity :

    Rat|Rattus norvegicus
  • Target :

    C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.
  • Type :

    Protein
  • Source :

    Yeast
  • Sequence :

    SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    11 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    C3
  • Protein Name :

    Complement C3
  • Gene Name URL :

    C3
  • CAS Number :

    9000-83-3
  • Nucleotide Accession Number :

    NM_016994

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide