LMP2 Recombinant Protein (Epstein-Barr virus)

CAT:
247-OPCA04340-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
LMP2 Recombinant Protein (Epstein-Barr virus) - image 1

LMP2 Recombinant Protein (Epstein-Barr virus)

  • Gene Name:

    Membrane protein LMP-2A|membrane protein LMP-2B
  • Gene Aliases:

    HHV4_LMP-2A; HHV4_LMP-2B; membrane protein LMP-2A; membrane protein LMP-2B; Terminal protein.
  • Gene ID:

    3783751|3783760
  • Accession Number:

    YP_401631
  • Reactivity:

    Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4
  • Target:

    Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS
  • Purification:

    Affinity purified using IMAC
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    31.6 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    LMP-2A|LMP-2B
  • Protein Name:

    Latent membrane protein 2
  • Gene Name URL:

    LMP-2A|LMP-2B
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NC_007605