Mup8 Recombinant Protein

• Gene Name:

  Major urinary protein 11|major urinary protein 18

• Gene Aliases:

  100039228; alpha-2U-globulin; Gm12549; Gm12561; group 1, BS6; major urinary protein 11; major urinary protein 16; Major urinary protein 18; Major urinary protein 6; major urinary protein 9; MUP 6; Mup16; Mup18; Mup6; Mup9.

• Gene ID:

  100039028|100048884

• Accession Number:

  NP_001157998.1

• Reactivity:

  Mouse|Mus musculus

• Target:

  Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable) . Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro (PubMed:25279835) .

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  19.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Mup11|Mup18

• Host or Source:

  Mouse

• Protein Name:

  Major urinary protein 11

• Gene Name URL:

  Mup11|Mup18

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001164526.1