MS4A1 Recombinant Protein (Mouse)

• Gene Name:

  Membrane-spanning 4-domains, subfamily A, member 1

• Gene Aliases:

  AA960661; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; Cd20; CD20 antigen; Ly-4; Ly-44; lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 2; Ms4a2.

• Gene ID:

  12482

• Accession Number:

  NP_031667

• Reactivity:

  Mouse|Mus musculus

• Target:

  This protein may be involved in the regulation of B-cell activation and proliferation.

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  22.3 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Ms4a1

• Protein Name:

  B-lymphocyte antigen CD20

• Gene Name URL:

  Ms4a1

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_007641