IL2RB Recombinant Protein (Mouse)

• Gene Name:

  Interleukin 2 receptor, beta chain

• Gene Aliases:

  CD122; high affinity IL-2 receptor subunit beta; IL-15 receptor beta chain; IL15R; IL-15R; IL15Rbeta; IL-15Rbeta; IL-2 receptor beta chain; IL-2 receptor subunit beta; IL-2/15 receptor-beta; Il-2/15Rbeta; Il-2R; IL-2R subunit beta; IL-2RB; Il-2Rbeta; interleukin-2 receptor subunit beta; p70; p70-75.

• Gene ID:

  16185

• Accession Number:

  NP_032394

• Reactivity:

  Mouse|Mus musculus

• Target:

  Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  27.1 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Il2rb

• Protein Name:

  Interleukin-2 receptor subunit beta

• Gene Name URL:

  Il2rb

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_008368