GADD45A Recombinant Protein (Human)

CAT:
247-OPCA03858-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GADD45A Recombinant Protein (Human) - image 1

GADD45A Recombinant Protein (Human)

  • Gene Name:

    Growth arrest and DNA damage inducible alpha
  • Gene Aliases:

    DDIT1; DDIT-1; DNA damage-inducible transcript 1 protein; DNA damage-inducible transcript-1; GADD45; growth arrest and DNA damage-inducible protein GADD45 alpha; growth arrest and DNA-damage-inducible 45 alpha.
  • Gene ID:

    1647
  • Accession Number:

    NP_001186670
  • Reactivity:

    Homo sapiens|Human
  • Target:

    In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity) . Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    34.3 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    GADD45A
  • Protein Name:

    Growth arrest and DNA damage-inducible protein GADD45 alpha
  • Gene Name URL:

    GADD45A
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001199741