Scgb3a2 Recombinant Protein

CAT:
247-OPCA03464-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Scgb3a2 Recombinant Protein - image 1

Scgb3a2 Recombinant Protein

  • Gene Name:

    Secretoglobin, family 3A, member 2
  • Gene Aliases:

    LuLe; LuLeu1; pneumo secretory protein 1; Pnsp1; secretoglobin family 3A member 2; UGR; UGRP1; uteroglobin related protein 1; Uteroglobin-related protein 1; Utgrp1.
  • Gene ID:

    117158
  • Accession Number:

    NP_001276572.1
  • Reactivity:

    Mouse|Mus musculus
  • Target:

    Secreted cytokine-like protein (By similarity) . Binds to the scavenger receptor MARCO (By similarity) . Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity) . Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919) . Seems to have anti-inflammatory effects in respiratory epithelium (PubMed:16456148, PubMed:25242865) . Also has anti-fibrotic activity in lung (PubMed:24213919, PubMed:26559674) . May play a role in fetal lung development and maturation (PubMed:18535256) . Promotes branching morphogenesis during early stages of lung development (PubMed:18535256) . In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (PubMed:24514953) .
  • Type:

    Protein
  • Source:

    Yeast
  • Sequence:

    LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    15.2 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    Scgb3a2
  • Host or Source:

    Mouse
  • Protein Name:

    Secretoglobin family 3A member 2
  • Gene Name URL:

    Scgb3a2
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001289643.1