Scgb3a2 Recombinant Protein

• Gene Name:

  Secretoglobin, family 3A, member 2

• Gene Aliases:

  LuLe; LuLeu1; pneumo secretory protein 1; Pnsp1; secretoglobin family 3A member 2; UGR; UGRP1; uteroglobin related protein 1; Uteroglobin-related protein 1; Utgrp1.

• Gene ID:

  117158

• Accession Number:

  NP_001276572.1

• Reactivity:

  Mouse|Mus musculus

• Target:

  Secreted cytokine-like protein (By similarity) . Binds to the scavenger receptor MARCO (By similarity) . Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity) . Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919) . Seems to have anti-inflammatory effects in respiratory epithelium (PubMed:16456148, PubMed:25242865) . Also has anti-fibrotic activity in lung (PubMed:24213919, PubMed:26559674) . May play a role in fetal lung development and maturation (PubMed:18535256) . Promotes branching morphogenesis during early stages of lung development (PubMed:18535256) . In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (PubMed:24514953) .

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  15.2 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Scgb3a2

• Host or Source:

  Mouse

• Protein Name:

  Secretoglobin family 3A member 2

• Gene Name URL:

  Scgb3a2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001289643.1