Products for Research Use Only
RegisterLogin

AaH2 Recombinant Protein

CAT: 0247-OPCA03379-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA03379-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
AaH II; Neurotoxin 2.
Reactivity
Androctonus australis
Target
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels (PubMed:23685008) . It is active on rat brain Nav1.2/SCN2A sodium channel (EC (50) =2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC (50) =2.2 nM) (PubMed:12911331), as well as on human neuronal Nav1.7/SCN9A (EC (50) =6.8 nM) (PubMed:23685008) . This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses (PubMed:23685008) .
Type
Protein
Source
E.coli
Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
23.3 kDa
Protein Length
Recombinant
Host or Source
Androctonus australis
Protein Name
Alpha-mammal toxin AaH2

Related Products

CatalogName
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
OPCD00940-10UGWAS Recombinant Protein
OPCD05912-10UGON Recombinant Protein
OPCD05911-200UGON Recombinant Protein
OPCD00940-50UGWAS Recombinant Protein
OPCD00762-50UGWAS Recombinant Protein
OPCD05911-50UGON Recombinant Protein
OPCD05911-10UGON Recombinant Protein
OPCD00762-10UGWAS Recombinant Protein

Alternative Products

CatalogName
GTR18881211-01Insect Alpha-mammal toxin AaH2 protein
AP73890-01Recombinant Androctonus australis Alpha-mammal toxin AaH2
372232-01Alpha-mammal Toxin AaH2, Recombinant, Androctonus Australis, aa20-83, His-SUMO-Tag
NBP2-34965Recombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
TMPY-00125Recombinant Protein A
abx461843-01Alpha-Mammal Toxin Aah2 (AaH2) Antibody
GTR18016405Aah2 Antibody

Popular Products