Products for Research Use Only
RegisterLogin

Disintegrin halysin Recombinant Protein

CAT: 0247-OPCA03228-1MGSize: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA03228-1MGSize:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
Platelet aggregation activation inhibitor.
Reactivity
Gloydius blomhoffii
Target
Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Type
Protein
Source
Yeast
Sequence
EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
9.5 kDa
Protein Length
Recombinant
Host or Source
Gloydius blomhoffii
Protein Name
Disintegrin halysin

Related Products

CatalogName
OPCA01961-20UGDisintegrin EC3B Recombinant Protein
OPCA01961-100UGDisintegrin EC3B Recombinant Protein
OPCA01961-1MGDisintegrin EC3B Recombinant Protein
OPCA00421-20UGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCA00421-1MGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCA00421-100UGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
OPCD00940-10UGWAS Recombinant Protein
OPCD05912-10UGON Recombinant Protein

Alternative Products

CatalogName
GTR18881053-01Reptile Disintegrin halysin protein
MBS1077989-01Recombinant Gloydius blomhoffii Disintegrin halysin
373060-01Disintegrin Halysin, Recombinant, Gloydius Blomhoffii, aa1-71, His-Tag
TMPH-00213-01Disintegrin batroxostatin Protein, Bothrops atrox, Recombinant (His & Myc)
MBS1265089-01Recombinant human Disintegrin and metalloproteinase domain-containing protein 15
MBS2903022Human ADAM9 / Disintegrin And Metalloproteinase Domain-Containing Protein 9 Recombinant Protein
R14640mMouse Adam12 / Disintegrin and metalloproteinase domain-containing protein 12 Recombinant Protein
R14287hHuman ADAM2 / Disintegrin and metalloproteinase domain-containing protein 2 Recombinant Protein
BLT-07853P-01Human ADAM8 (Disintegrin And Metalloproteinase Domain-Containing Protein 8) - Recombinant Protein
BLT-08770P-01Human ADAM17 (Disintegrin And Metalloproteinase Domain-Containing Protein 17) - Recombinant Protein

Popular Products