Products for Research Use Only
RegisterLogin

Disintegrin EC3B Recombinant Protein

CAT: 0247-OPCA01961-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA01961-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
Disintegrin EC3B
Reactivity
Echis carinatus
Target
Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1) . It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.
Type
Protein
Source
E.coli
Sequence
NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
23.4 kDa
Protein Length
Recombinant
Host or Source
Echis carinatus
Protein Name
Disintegrin EC3B

Related Products

CatalogName
OPCA03228-100UGDisintegrin halysin Recombinant Protein
OPCA03228-20UGDisintegrin halysin Recombinant Protein
OPCA03228-1MGDisintegrin halysin Recombinant Protein
OPCA00421-20UGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCA00421-1MGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCA00421-100UGRecombinant human Disintegrin and metallo proteinase domain-containing protein 15
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
OPCD00940-10UGWAS Recombinant Protein
OPCD05912-10UGON Recombinant Protein

Alternative Products

CatalogName
AP70954-01Recombinant Echis carinatus Disintegrin EC3B
GTR18880825-01E.coli Echis carinatus Disintegrin EC3B protein
584264-01Disintegrin EC3B, Recombinant, Echis carinatus, aa1-67, His-SUMO-Tag
TMPH-00213-01Disintegrin batroxostatin Protein, Bothrops atrox, Recombinant (His & Myc)
MBS1265089-01Recombinant human Disintegrin and metalloproteinase domain-containing protein 15
MBS2903022Human ADAM9 / Disintegrin And Metalloproteinase Domain-Containing Protein 9 Recombinant Protein
R14640mMouse Adam12 / Disintegrin and metalloproteinase domain-containing protein 12 Recombinant Protein
R14287hHuman ADAM2 / Disintegrin and metalloproteinase domain-containing protein 2 Recombinant Protein
BLT-08770P-01Human ADAM17 (Disintegrin And Metalloproteinase Domain-Containing Protein 17) - Recombinant Protein
BLT-07853P-01Human ADAM8 (Disintegrin And Metalloproteinase Domain-Containing Protein 8) - Recombinant Protein

Popular Products