Tgfb1 Recombinant Protein

• Gene Name:

  Transforming growth factor beta 1 L homeolog

• Gene Aliases:

  Ced; dpd1; lap; tgf beta; tgfb; tgfb1; tgfb5; tgfbeta; tgf-beta; tgf-beta 5; TGF-beta-1; TGF-beta5; TGF-beta-5; transforming gorwth factor-Beta5; transforming growth factor beta-1 proprotein; transforming growth factor-B5; transforming growth factor-beta 5 (TGF-beta 5) ; XELAEV_18039344mg.

• Gene ID:

  397778

• Accession Number:

  NP_001081330.1

• Reactivity:

  Xenopus laevis

• Target:

  Important role in certain aspects of differentiation.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  28.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Tgfb1.L

• Host or Source:

  Xenopus laevis

• Protein Name:

  Transforming growth factor beta-1

• Gene Name URL:

  Tgfb1.L

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001087861.1