Products for Research Use Only
RegisterLogin

LMP1 Recombinant Protein

CAT: 0247-OPCA02861-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02861-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
Protein p63.
Reactivity
Epstein-Barr virus|Epstein-Barr Virus
Target
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.
Type
Protein
Source
Yeast
Sequence
YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
23 kDa
Protein Length
Recombinant
NCBI Gene Symbol
LMP1
Host or Source
Epstein-Barr virus
Protein Name
Latent membrane protein 1
Gene Name URL
LMP1

Related Products

CatalogName
OPCA04340-1MGLMP2 Recombinant Protein (Epstein-Barr virus)
OPCA04340-100UGLMP2 Recombinant Protein (Epstein-Barr virus)
OPCA04672-100UGLMP2 Recombinant Protein (Human herpesvirus 4)
OPCA04672-20UGLMP2 Recombinant Protein (Human herpesvirus 4)
OPCA04340-20UGLMP2 Recombinant Protein (Epstein-Barr virus)
OPCA04672-500UGOPCA04672-500UG - LMP2 Recombinant Protein (Human herpesvirus 4)
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
OPCD00940-10UGWAS Recombinant Protein
OPCD05912-10UGON Recombinant Protein

Alternative Products

CatalogName
GTR19085287-01Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1)
AP77183Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1) , partial
CSB-YP318333EFE-01Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial
GTR19134247-01Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1) -VLPs
AP70984-01Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1), partial
GTR18883837-01Virus LMP1 protein
GTR18883018-01Human LMP1 protein
GTR18880577-01Yeast LMP1 protein
GTR18882425-01E.coli LMP1 protein
MBS8504781-01LMP1 Antibody

Popular Products