Dio2 Recombinant Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Dio2 Recombinant Protein
Gene Name :
Iodothyronine deiodinase 2Gene Aliases :
5DII; deiodinase, iodothyronine, type 2; deiodinase, iodothyronine, type II; DIOII; type 2 DI; type II iodothyronine deiodinase; type-II 5'-deiodinase.Gene ID :
65162Accession Number :
NP_113908.3Reactivity :
Rat|Rattus norvegicusTarget :
Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) . Essential for providing the brain with appropriate levels of T3 during the critical period of development.Type :
ProteinSource :
YeastSequence :
MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILDAssay Protocol :
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat :
Liquid or Lyophilized powderBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
-20°C or -80°CMolecular Weight :
31.8 kDaProtein Length :
RecombinantNCBI Gene Symbol :
Dio2Host or Source :
RatProtein Name :
Type II iodothyronine deiodinaseGene Name URL :
Dio2CAS Number :
9000-83-3Nucleotide Accession Number :
NM_031720.3

