Products for Research Use Only
RegisterLogin

ATP5D Recombinant Protein

CAT: 0247-OPCA02600-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02600-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
ATP synthase F1 subunit delta
Gene Aliases
ATP synthase F1 subunit delta; ATP synthase subunit delta, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP5D; F-ATPase delta subunit; MC5DN5; mitochondrial ATP synthase complex delta-subunit precusor; mitochondrial ATP synthase, delta subunit.
Gene ID
513
Reactivity
Homo sapiens|Human
Target
Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha (3) beta (3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Type
Protein
Source
Yeast
Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
17 kDa
Protein Length
Recombinant
NCBI Gene Symbol
ATP5F1D
Host or Source
Human
Protein Name
ATP synthase subunit delta, mitochondrial
Gene Name URL
ATP5F1D

Related Products

CatalogName
OOPA00152-1UGATP5D Protein
OACA02629-100UGATP5D Antibody
OACA02629-50UGATP5D Antibody
OAAF03317-100UGATP5D Antibody
OACA08857-50ULATP5D Antibody
OAGA00099-100ULATP5D antibody
OACA08857-100ULATP5D Antibody
OAAF03317-100UG-HRPATP5D Antibody : HRP (OAAF03317-HRP)
OAAF03317-100UG-FITCATP5D Antibody : FITC (OAAF03317-FITC)
OAAF03317-100UG-BiotinATP5D Antibody : Biotin (OAAF03317-Biotin)

Alternative Products

CatalogName
32-2171-5ATP5D Recombinant Protein
ARP1273-01Recombinant Human ATP5D Protein
RP002314ATP5D Recombinant Protein (Human)
NBP1-86162PEPATP5D Recombinant Protein Antigen
RP117986ATP5D Recombinant Protein (Mouse)
RP191468ATP5D Recombinant Protein (Rat)
TP501389Atp5d (NM_025313) Mouse Recombinant Protein
TMPY-03609-01ATP5D Protein, Human, Recombinant (His)
E45H51811E1-100ATP5D Protein, Human, Recombinant (His Tag)
QP5695-ye-200ugRecombinant Human ATP5D Protein, His, Yeast-200ug

Popular Products