Products for Research Use Only
RegisterLogin

MBNL1 Recombinant Protein

CAT: 0247-OPCA02533-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02533-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the st-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assbly. Binds to the 5'-YGCU (U/G) Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues.
CAS Number
9000-83-3
Gene Name
Muscleblind like splicing regulator 1
Gene Aliases
EXP; MBNL; muscleblind-like; muscleblind-like protein 1; triplet-expansion RNA-binding protein.
Gene ID
4154
Accession Number
NP_001300986.1
Reactivity
Homo sapiens|Human
Target
Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU (U/G) Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues.
Type
Protein
Source
E.coli
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Purification
Affinity purified using IMAC
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Reconstitution
-20°C or -80°C
Molecular Weight
57 kDa
Protein Length
Recombinant
NCBI Gene Symbol
MBNL1
Host or Source
Human
Protein Name
Muscleblind-like protein 1
Gene Name URL
MBNL1
Nucleotide Accession Number
NM_001314057.1

Related Products

CatalogName
OCOA03535-20UGMBNL1 Protein Lysate
OCOA03536-20UGMBNL1 Protein Lysate
OCOA03532-20UGMBNL1 Protein Lysate
OCOA03533-20UGMBNL1 Protein Lysate
OCOA03537-20UGMBNL1 Protein Lysate
OCOA03534-20UGMBNL1 Protein Lysate
OCOA02558-20UGMBNL1 Protein Lysate
OAAN02582-200ULMBNL1 Antibody
OAAN02582-100ULMBNL1 Antibody
OAGA04075-100ULMBNL1 Antibody

Alternative Products

CatalogName
RP149681MBNL1 Recombinant Protein (Mouse)
RP018919MBNL1 Recombinant Protein (Human)
RP211019MBNL1 Recombinant Protein (Rat)
E30P11507Recombinant Human MBNL1 Protein
PROTQ9NR56MBNL1 (NM_207295) Human Recombinant Protein
PH34069M5MBNL1 (NM_207293) Human Recombinant Protein
PH34037M5MBNL1 (NM_207296) Human Recombinant Protein
TP308112MBNL1 (NM_021038) Human Recombinant Protein
TP323199MMBNL1 (NM_207297) Human Recombinant Protein

Popular Products