Cd74 Recombinant Protein

CAT:
247-OPCA01510-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Cd74 Recombinant Protein - image 1

Cd74 Recombinant Protein

  • CAS Number :

    9000-83-3
  • Gene Name :

    CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
  • Gene Aliases :

    C; class II-associated invariant chain peptide; CLIP; DHLAG; dinucleotide microsatellite; H-2 class II histocompatibility antigen gamma chain; histocompatibility: class II antigens, gamma chain of; HLADG; HLA-DR-GAMMA; ia antigen-associated invariant chain; Ia-associated invariant chain; Ia-GAMMA; Ii; ii chain; invariant polypeptide of major histocompatibility complex, class II antigen-associated; MHC class II-associated invariant chain.
  • Gene ID :

    16149
  • Accession Number :

    NP_001036070.1
  • Reactivity :

    Mouse|Mus musculus
  • Target :

    Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    29.4 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    Cd74
  • Host or Source :

    Mouse
  • Protein Name :

    H-2 class II histocompatibility antigen gamma chain
  • Gene Name URL :

    Cd74
  • Nucleotide Accession Number :

    NM_001042605.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide