C1qa Recombinant Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


C1qa Recombinant Protein
Gene Name:
Complement component 1, q subcomponent, alpha polypeptideGene Aliases:
Adic; adiponectin c; AI255395; C1q; complement C1q subcomponent subunit A.Gene ID:
12259Accession Number:
NP_031598.2Reactivity:
Mouse|Mus musculusTarget:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.Type:
ProteinSource:
E.coliSequence:
Full of Length of Mature Protein:// EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSAPurification:
Affinity purified using IMACAssay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat:
Lyophilized// 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)Reconstitution:
We recommend that this briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/ml. We recommend to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20° C/-80° C. Our default final concentration of glycerol is 50%. Store working aliquots at 4° C for up to one week. Repeated freeze/thaw cycles are not recommended.Molecular Weight:
40 kDaProtein Length:
RecombinantNCBI Gene Symbol:
C1qaHost or Source:
MouseProtein Name:
Complement C1q subcomponent subunit AGene Name URL:
C1qaCAS Number:
9000-83-3Nucleotide Accession Number:
NM_007572.2
