Recombinant Mouse Integrin alpha-L

CAT: 0247-OPCA01260-100UGSize: 100 µgDry Ice: NoHazardous: No
CAT#:0247-OPCA01260-100UGSize:100 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
CAS Number
9000-83-3
Gene Name
Integrin alpha L
Gene Aliases
(p180) ; alpha L integrin; Cd11; CD11 antigen-like family member A; Cd11a; integrin alpha-L; leukocyte adhesion glycoprotein LFA-1 alpha chain; leukocyte function-associated molecule 1 alpha chain; LFA; LFA-1; LFA-1A; Ly-1; Ly-15; Ly-2; Ly-21; lymphocyte antigen 15; lymphocyte function associated antigen 1, alpha polypeptide.
Gene ID
16408
Reactivity
Mouse|Mus musculus
Target
Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4 (PubMed:2051027) . Integrin ITGAL/ITGB2 is a receptor for F11R (By similarity) . Integrin ITGAL/ITGB2 is a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL (PubMed:29100055) . Involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (PubMed:16234355, PubMed:24158516) . Required for generation of common lymphoid progenitor cells in bone marrow, indicating the role in lymphopoiesis (PubMed:25108025) . Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages.
Type
Protein
Source
Yeast
Sequence
DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
21.7 kDa
Protein Length
Recombinant
NCBI Gene Symbol
Itgal
Protein Name
Integrin alpha-L
Gene Name URL
Itgal

Related Products

CatalogName
OAEB01283-100UGGoat Anti-CD11A / integrin alpha L Antibody
OAAV01159-200UGIntegrin alpha 4 Recombinant Antibody [Natalizumab]
OAAV00866-200UGIntegrin alpha 4 Recombinant Antibody [Natalizumab] (OAAV00402)
OAAV00867-200UGIntegrin alpha 4 Recombinant Antibody [Natalizumab] (OAAV00403)
OAAV00784-200UGIntegrin Alpha-M Recombinant Antibody [107] (OAAV00320)
OAAV00846-200UGAlpha-4 integrin Recombinant Antibody [21.6] (OAAV00382)
OAAV00847-200UGAlpha-4 integrin Recombinant Antibody [21.6] (OAAV00383)
OAAV01228-200UGAlpha 5 beta 1 Integrin Recombinant Antibody [M200 (Volociximab) ]
OAAV00403-200UGOAAV00403-200UG - Integrin Alpha 4 Antibody
OABI00008-100UGOABI00008-100UG - Integrin alpha 5 Antibody

Alternative Products

CatalogName
MBS9420371-01Recombinant mouse Integrin alpha-L
RC-15418-01Recombinant Integrin alpha-L Antibody
R1572mMouse Itgal / Integrin alpha-L Recombinant Protein
AP72629Recombinant Mouse Integrin alpha-L (Itgal) , partial
CSB-YP011875MO-01Recombinant Mouse Integrin alpha-L (Itgal), partial
AP70455-01Recombinant Mouse Integrin alpha-L(Itgal), partial
BS46154-01Integrin alpha L Recombinant Rabbit mAb
7825-AB-050Recombinant Mouse Integrin alpha L beta 2 CF
MBS289663-01Mouse Integrin alpha-L ELISA Kit
MBS767641-01CD11a/Integrin alpha-L Mouse Monoclonal

Popular Products