Recombinant Mouse C-X-C motif chemokine 2 protein

• Gene Name:

  Chemokine (C-X-C motif) ligand 2

• Gene Aliases:

  CINC; CINC-2a; C-X-C motif chemokine 2; Gr; Gro2; GROb; macrophage inflammatory protein 2; Mgsa; Mgsa-b; Mi; MIP; Mip2; MIP-2; MIP-2a; Scy; Scyb; Scyb2; small inducible cytokine subfamily, member 2.

• Gene ID:

  20310

• Reactivity:

  Mouse|Mus musculus

• Target:

  Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  11.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Cxcl2

• Protein Name:

  C-X-C motif chemokine 2

• Gene Name URL:

  Cxcl2

• CAS Number:

  9000-83-3