Recombinant Mouse C-X-C motif chemokine 2 protein

CAT:
247-OPCA00803-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse C-X-C motif chemokine 2 protein - image 1

Recombinant Mouse C-X-C motif chemokine 2 protein

  • Gene Name:

    Chemokine (C-X-C motif) ligand 2
  • Gene Aliases:

    CINC; CINC-2a; C-X-C motif chemokine 2; Gr; Gro2; GROb; macrophage inflammatory protein 2; Mgsa; Mgsa-b; Mi; MIP; Mip2; MIP-2; MIP-2a; Scy; Scyb; Scyb2; small inducible cytokine subfamily, member 2.
  • Gene ID:

    20310
  • Reactivity:

    Mouse|Mus musculus
  • Target:

    Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    11.8 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    Cxcl2
  • Protein Name:

    C-X-C motif chemokine 2
  • Gene Name URL:

    Cxcl2
  • CAS Number:

    9000-83-3