Recombinant human Rhombotin-1

• Gene Name:

  LIM domain only 1

• Gene Aliases:

  Cysteine-rich protein TTG-1; LIM domain only 1 (rhombotin 1) ; LIM domain only protein 1; LMO-1; RBTN1; RHOM1; rhombotin-1; T-cell translocation gene 1; T-cell translocation protein 1; TTG1.

• Gene ID:

  4004

• Reactivity:

  Homo sapiens|Human

• Target:

  May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  44.4 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  LMO1

• Protein Name:

  Rhombotin-1

• Gene Name URL:

  LMO1

• CAS Number:

  9000-83-3