Recombinant Mouse Hemoglobin subunit beta-2

CAT:
247-OPCA00280-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Hemoglobin subunit beta-2 - image 1

Recombinant Mouse Hemoglobin subunit beta-2

  • Gene Name :

    Hemoglobin, beta adult minor chain
  • Gene Aliases :

    AI036344; beta min; beta minor globin; beta2; Beta-2-globin; Hbb2; Hbbt2; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain; hemoglobin subunit beta-2.
  • Gene ID :

    15130
  • Reactivity :

    Mouse|Mus musculus
  • Target :

    Involved in oxygen transport from the lung to the various peripheral tissues.
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    42.7 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    Hbb-b2
  • Protein Name :

    Hemoglobin subunit beta-2
  • Gene Name URL :

    Hbb-b2
  • CAS Number :

    9000-83-3

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide