Recombinant Mouse Hemoglobin subunit beta-2

• Gene Name :

  Hemoglobin, beta adult minor chain

• Gene Aliases :

  AI036344; beta min; beta minor globin; beta2; Beta-2-globin; Hbb2; Hbbt2; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain; hemoglobin subunit beta-2.

• Gene ID :

  15130

• Reactivity :

  Mouse|Mus musculus

• Target :

  Involved in oxygen transport from the lung to the various peripheral tissues.

• Type :

  Protein

• Source :

  Yeast

• Sequence :

  VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  17.7 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  Hbb-b2

• Protein Name :

  Hemoglobin subunit beta-2

• Gene Name URL :

  Hbb-b2

• CAS Number :

  9000-83-3