FBXO7 Antibody

CAT:
247-OAAN03680-200UL
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
FBXO7 Antibody - image 1

FBXO7 Antibody

  • Gene Name :

    F-box protein 7
  • Gene Aliases :

    FBX, FBX7, PKPS, FBX07, PARK15
  • Gene ID :

    25793
  • Swiss Prot :

    Q9Y3I1
  • Accession Number :

    NP_001028196.1
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    NP_036311.3
  • Target :

    This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    LSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
  • Applications :

    WB, IF
  • Purification :

    Affinity purified
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
  • Reconstitution :

    Store at -20° C. Avoid freeze/thaw cycles.
  • Molecular Weight :

    59 kDa
  • Fragment :

    IgG
  • NCBI Gene Symbol :

    FBXO7
  • Host or Source :

    Rabbit
  • Protein Name :

    Estrogen sulfotransferase
  • Gene Name URL :

    FBXO7
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_001033024.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide