RDH12 Antibody

• Gene Name:

  Retinol dehydrogenase 12

• Gene Aliases:

  All-trans and 9-cis retinol dehydrogenase; LCA13; retinol dehydrogenase 12; retinol dehydrogenase 12 (all-trans/9-cis/11-cis) ; retinol dehydrogenase 12, all-trans and 9-cis; RP53; SDR7C2; short chain dehydrogenase/reductase family 7C member 2.

• Gene ID:

  145226

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_689656.1

• Reactivity:

  Human, Mouse

• Immunogen:

  RDH12 (NP_689656.1, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3) . [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  100000000000

• Type:

  Monoclonal Antibody

• Sequence:

  RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  RDH12

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens retinol dehydrogenase 12 (RDH12), mRNA|retinol dehydrogenase 12 precursor [Homo sapiens]

• Gene Name URL:

  RDH12

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_152443