PDCL3 Antibody

CAT:
247-OAAL00803-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PDCL3 Antibody - image 1

PDCL3 Antibody

  • Gene Name :

    Phosducin like 3
  • Gene Aliases :

    HTPHLP; IAP-associated factor VIAF1; PHLP2A; PHLP3; phosducin-like protein 3; phPL3; VIAF; VIAF1; VIAF-1; viral IAP-associated factor 1.
  • Gene ID :

    79031
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH01021
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PDCL3 (AAH01021, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a member of the phosducin-like protein family and is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin. Members of the phosducin-like protein family have been shown to bind to the beta-gamma subunits of G proteins. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    2D7
  • Type :

    Monoclonal Antibody
  • Sequence :

    MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    PDCL3
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens phosducin-like 3, mRNA (cDNA clone MGC:3062 IMAGE:3344703), complete cds|Phosducin-like 3 [Homo sapiens]
  • Gene Name URL :

    PDCL3
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC001021

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide