PARD3 Antibody

CAT:
247-OAAL00752-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PARD3 Antibody - image 1

PARD3 Antibody

  • Gene Name:

    Par-3 family cell polarity regulator
  • Gene Aliases:

    ASIP; atypical PKC isotype-specific interacting protein; Baz; bazooka; CTCL tumor antigen se2-5; PAR3; par-3 family cell polarity regulator alpha; par-3 partitioning defective 3 homolog; PAR3alpha; PAR3-alpha; PARD-3; PARD3A; partitioning defective 3 homolog; PPP1R118; protein phosphatase 1, regulatory subunit 118; SE2-5L16; SE2-5LT1; SE2-5T2.
  • Gene ID:

    56288
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/AAH11711
  • Reactivity:

    Human, Mouse
  • Immunogen:

    PARD3 (AAH11711, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 (MIM 116952) mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange factors (GEFs; see MIM 606057) and GTPase-activating proteins (GAPs; see MIM 604980), interacts with a large set of effector proteins that typically contain a CDC42/RAC (MIM 602048) -interactive binding (CRIB) domain.[supplied by OMIM
  • Clonality:

    Monoclonal
  • Clone:

    4G5
  • Type:

    Monoclonal Antibody
  • Sequence:

    KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
  • Applications:

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a Kappa
  • NCBI Gene Symbol:

    PARD3
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens par-3 partitioning defective 3 homolog (C. elegans), mRNA (cDNA clone IMAGE:3939370), partial cds|PARD3 protein, partial [Homo sapiens]
  • Gene Name URL:

    PARD3
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/BC011711