RIPK4 Antibody

• Gene Name:

  Receptor interacting serine/threonine kinase 4

• Gene Aliases:

  ANKK2; ANKRD3; ankyrin repeat domain-containing protein 3; CHANDS; DIK; NKRD3; PKC-delta-interacting protein kinase; PKK; PPS2; protein kinase C-associated kinase; receptor-interacting serine/threonine-protein kinase 4; RIP4; serine/threonine-protein kinase ANKRD3.

• Gene ID:

  54101

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_065690

• Reactivity:

  Human, Mouse

• Immunogen:

  RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  3B1

• Type:

  Monoclonal Antibody

• Sequence:

  HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  RIPK4

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens receptor interacting serine/threonine kinase 4 (RIPK4), mRNA|receptor-interacting serine/threonine-protein kinase 4 [Homo sapiens]

• Gene Name URL:

  RIPK4

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_020639