INTS6 Antibody

• Gene Name:

  Integrator complex subunit 6

• Gene Aliases:

  DBI-1; DDX26; DDX26A; DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26; DICE1; HDB; INT6; integrator complex subunit 6; Notchl2; protein deleted in cancer 1; RNA helicase HDB.

• Gene ID:

  26512

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_036273

• Reactivity:

  Human, Mouse

• Immunogen:

  DDX26 (NP_036273, 779 a.a. ~ 887 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH) . Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  3D9

• Type:

  Monoclonal Antibody

• Sequence:

  DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid. Supplied in 1x PBS, pH 7.4.

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  INTS6

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens integrator complex subunit 6 (INTS6), transcript variant 1, mRNA|integrator complex subunit 6 isoform a [Homo sapiens]

• Gene Name URL:

  INTS6

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_012141