INTS6 Antibody

CAT:
247-OAAL00635-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
INTS6 Antibody - image 1

INTS6 Antibody

  • Gene Name :

    Integrator complex subunit 6
  • Gene Aliases :

    DBI-1; DDX26; DDX26A; DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26; DICE1; HDB; INT6; integrator complex subunit 6; Notchl2; protein deleted in cancer 1; RNA helicase HDB.
  • Gene ID :

    26512
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_036273
  • Reactivity :

    Human, Mouse
  • Immunogen :

    DDX26 (NP_036273, 779 a.a. ~ 887 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH) . Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3D9
  • Type :

    Monoclonal Antibody
  • Sequence :

    DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid. Supplied in 1x PBS, pH 7.4.
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    INTS6
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens integrator complex subunit 6 (INTS6), transcript variant 1, mRNA|integrator complex subunit 6 isoform a [Homo sapiens]
  • Gene Name URL :

    INTS6
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_012141

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide