CHMP2B Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  Charged multivesicular body protein 2B

• Gene Aliases :

  ALS17; charged multivesicular body protein 2b; CHMP2.5; chromatin modifying protein 2B; DMT1; FTDALS7; vacuolar protein-sorting-associated protein 2-2; VPS2 homolog B; VPS2-2; VPS2B.

• Gene ID :

  25978

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH01553.1

• Reactivity :

  Human, Mouse

• Immunogen :

  CHMP2B (AAH01553.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2H6-1E6

• Type :

  Monoclonal Antibody

• Sequence :

  MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD

• Applications :

  Enzyme-linked immunosorbent assay

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 kappa

• NCBI Gene Symbol :

  CHMP2B

• Host or Source :

  Mouse

• Protein Name :

  Chromatin modifying protein 2B [Homo sapiens]|Homo sapiens chromatin modifying protein 2B, mRNA (cDNA clone MGC:5027 IMAGE:3460712), complete cds

• Gene Name URL :

  CHMP2B

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC001553.1