RASGRP3 Antibody

• Gene Name :

  RAS guanyl releasing protein 3

• Gene Aliases :

  Calcium and DAG-regulated guanine nucleotide exchange factor III; calcium- and diacylglycerol-regulated guanine nucleotide exchange factor III; CalDAG-GEFIII; GRP3; guanine nucleotide exchange factor for Rap1; RAS guanyl releasing protein 3 (calcium and DAG-regulated) ; ras guanyl-releasing protein 3.

• Gene ID :

  25780

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_733772.1

• Reactivity :

  Human, Mouse

• Immunogen :

  RASGRP3 (NP_733772.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]) .[supplied by OMIM

• Clonality :

  Monoclonal

• Clone :

  1H4

• Type :

  Monoclonal Antibody

• Sequence :

  MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMT

• Applications :

  Enzyme-linked immunosorbent assay

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1 mg/ml

• Format :

  Liquid.// 1x PBS, pH 7.4

• Reconstitution :

  Store at -20° C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  RASGRP3

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens RAS guanyl releasing protein 3 (RASGRP3), transcript variant 2, mRNA|ras guanyl-releasing protein 3 isoform 1 [Homo sapiens]

• Gene Name URL :

  RASGRP3

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_170672