ADNP Antibody

• Gene Name:

  Activity dependent neuroprotector homeobox

• Gene Aliases:

  Activity-dependent neuroprotective protein; activity-dependent neuroprotector; activity-dependent neuroprotector homeobox protein; ADNP homeobox 1; ADNP1; HVDAS; MRD28.

• Gene ID:

  23394

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_056154

• Reactivity:

  Human, Mouse

• Immunogen:

  ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  2C5

• Type:

  Monoclonal Antibody

• Sequence:

  TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  ADNP

• Host or Source:

  Mouse

• Protein Name:

  Activity-dependent neuroprotector homeobox protein [Homo sapiens]|Homo sapiens activity dependent neuroprotector homeobox (ADNP), transcript variant 1, mRNA

• Gene Name URL:

  ADNP

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_015339