EDAR Antibody

CAT:
247-OAAL00548-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EDAR Antibody - image 1

EDAR Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Ectodysplasin A receptor
  • Gene Aliases :

    Anhidrotic ectodysplasin receptor 1; DL; downless homolog; downless, mouse, homolog of; ECTD10A; ECTD10B; ectodermal dysplasia receptor; ectodysplasin 1, anhidrotic receptor; ED1R; ED3; ED5; EDA1R; EDA3; EDA-A1 receptor; EDA-A1R; HRM1; tumor necrosis factor receptor superfamily member EDAR.
  • Gene ID :

    10913
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_071731
  • Reactivity :

    Human, Mouse
  • Immunogen :

    EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    6C12
  • Type :

    Monoclonal Antibody
  • Sequence :

    TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2b Kappa
  • NCBI Gene Symbol :

    EDAR
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens ectodysplasin A receptor (EDAR), mRNA|tumor necrosis factor receptor superfamily member EDAR precursor [Homo sapiens]
  • Gene Name URL :

    EDAR
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_022336

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide