RNF40 Antibody

• Gene Name:

  Ring finger protein 40

• Gene Aliases:

  95 kDa retinoblastoma protein binding protein;95 kDa retinoblastoma-associated protein; BRE1 E3 ubiquitin ligase homolog B; BRE1B; BRE1-B; E3 ubiquitin-protein ligase BRE1B; Rb-associated protein; RBP95; ring finger protein 40, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase BRE1B; STARING.

• Gene ID:

  9810

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_055586

• Reactivity:

  Human, Mouse

• Immunogen:

  RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1C1

• Type:

  Monoclonal Antibody

• Sequence:

  DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  RNF40

• Host or Source:

  Mouse

• Protein Name:

  E3 ubiquitin-protein ligase BRE1B isoform 1 [Homo sapiens]|Homo sapiens ring finger protein 40 (RNF40), transcript variant 1, mRNA

• Gene Name URL:

  RNF40

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_014771