PPM1F Antibody

CAT:
247-OAAL00470-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PPM1F Antibody - image 1

PPM1F Antibody

  • Gene Name :

    Protein phosphatase, Mg2+/Mn2+ dependent 1F
  • Gene Aliases :

    Ca (2+) /calmodulin-dependent protein kinase phosphatase; CaM-kinase phosphatase; CAMKP; CaMKPase; FEM-2; hFEM-2; partner of PIX 2; POPX2; PP2C phosphatase; protein fem-2 homolog; protein phosphatase 1F; protein phosphatase 1F (PP2C domain containing) .
  • Gene ID :

    9647
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_055449
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1G10
  • Type :

    Monoclonal Antibody
  • Sequence :

    MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
  • Applications :

    Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    PPM1F
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens protein phosphatase, Mg2+/Mn2+ dependent 1F (PPM1F), mRNA|protein phosphatase 1F [Homo sapiens]
  • Gene Name URL :

    PPM1F
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_014634

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide