CDY2A Antibody

CAT:
247-OAAL00451-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CDY2A Antibody - image 1

CDY2A Antibody

  • Gene Name:

    Chromodomain Y-linked 2A
  • Gene Aliases:

    CDY; CDY2; chromodomain protein, Y chromosome, 2; chromodomain protein, Y-linked, 2A; testis-specific chromodomain protein Y 2; Y chromosome chromodomain protein 2A.
  • Gene ID:

    9426
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_004816
  • Reactivity:

    Human, Mouse
  • Immunogen:

    CDY2A (NP_004816, 123 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    This intronless gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    4C8
  • Type:

    Monoclonal Antibody
  • Sequence:

    ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS
  • Applications:

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG1 Kappa
  • NCBI Gene Symbol:

    CDY2A
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens chromodomain Y-linked 2A (CDY2A), mRNA|testis-specific chromodomain protein Y 2 [Homo sapiens]
  • Gene Name URL:

    CDY2A
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004825