USP10 Antibody

• Gene Name :

  Ubiquitin specific peptidase 10

• Gene Aliases :

  Deubiquitinating enzyme 10; ubiquitin carboxyl-terminal hydrolase 10; ubiquitin specific protease 10; ubiquitin thioesterase 10; ubiquitin thiolesterase 10; ubiquitin-specific-processing protease 10; UBPO.

• Gene ID :

  9100

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_005144

• Reactivity :

  Human, Mouse

• Immunogen :

  USP10 (NP_005144, 699 a.a. ~ 797 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3B8

• Type :

  Monoclonal Antibody

• Sequence :

  KLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDL

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  USP10

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens ubiquitin specific peptidase 10 (USP10), transcript variant 2, mRNA|ubiquitin carboxyl-terminal hydrolase 10 isoform 2 [Homo sapiens]

• Gene Name URL :

  USP10

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_005153