EIF4EBP3 Antibody

• Gene Name:

  Eukaryotic translation initiation factor 4E binding protein 3

• Gene Aliases:

  4EBP3;4E-BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3.

• Gene ID:

  8637

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH10881

• Reactivity:

  Human, Mouse

• Immunogen:

  EIF4EBP3 (AAH10881, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1000

• Type:

  Monoclonal Antibody

• Sequence:

  MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  EIF4EBP3

• Host or Source:

  Mouse

• Protein Name:

  Eukaryotic translation initiation factor 4E binding protein 3 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 4E binding protein 3, mRNA (cDNA clone IMAGE:3542582), complete cds

• Gene Name URL:

  EIF4EBP3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC010881