EIF4EBP3 Antibody

CAT:
247-OAAL00406-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EIF4EBP3 Antibody - image 1

EIF4EBP3 Antibody

  • Gene Name :

    Eukaryotic translation initiation factor 4E binding protein 3
  • Gene Aliases :

    4EBP3;4E-BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3.
  • Gene ID :

    8637
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH10881
  • Reactivity :

    Human, Mouse
  • Immunogen :

    EIF4EBP3 (AAH10881, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1000
  • Type :

    Monoclonal Antibody
  • Sequence :

    MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    EIF4EBP3
  • Host or Source :

    Mouse
  • Protein Name :

    Eukaryotic translation initiation factor 4E binding protein 3 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 4E binding protein 3, mRNA (cDNA clone IMAGE:3542582), complete cds
  • Gene Name URL :

    EIF4EBP3
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC010881