UBTF Antibody

CAT:
247-OAAL00350-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
UBTF Antibody - image 1

UBTF Antibody

  • Gene Name :

    Upstream binding transcription factor
  • Gene Aliases :

    90-kDa nucleolus organizer region autoantigen; autoantigen NOR-90; CONDBA; NOR-90; nucleolar transcription factor 1; UBF; UBF1; UBF-1; UBF2; upstream binding transcription factor, RNA polymerase I.
  • Gene ID :

    7343
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_055048
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs') . Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]) . UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]) .[supplied by OMIM
  • Clonality :

    Monoclonal
  • Clone :

    6C6
  • Type :

    Monoclonal Antibody
  • Sequence :

    PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    UBTF
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens upstream binding transcription factor (UBTF), transcript variant 1, mRNA|nucleolar transcription factor 1 isoform a [Homo sapiens]
  • Gene Name URL :

    UBTF
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_014233

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide