TULP2 Antibody

• Gene Name:

  TUB like protein 2

• Gene Aliases:

  Cancer testis antigen 65; CT65; tubby like protein 2; tubby-related protein 2; TUBL2.

• Gene ID:

  7288

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_003314

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  TULP2 (NP_003314, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  2B5

• Type:

  Monoclonal Antibody

• Sequence:

  EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  TULP2

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens tubby like protein 2 (TULP2), mRNA|tubby-related protein 2 [Homo sapiens]

• Gene Name URL:

  TULP2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_003323