MAP2K5 Antibody

CAT:
247-OAAL00261-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAP2K5 Antibody - image 1

MAP2K5 Antibody

  • Gene Name :

    Mitogen-activated protein kinase kinase 5
  • Gene Aliases :

    Dual specificity mitogen-activated protein kinase kinase 5; HsT17454; MAP kinase kinase 5; MAP kinase kinase MEK5b; MAPK/ERK kinase 5; MAPKK 5; MAPKK5; MEK 5; MEK5; PRKMK5.
  • Gene ID :

    5607
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH08838
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MAP2K5 (AAH08838, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs) . The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    100000
  • Type :

    Monoclonal Antibody
  • Sequence :

    MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Proximity ligation assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    MAP2K5
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens mitogen-activated protein kinase kinase 5, mRNA (cDNA clone MGC:14094 IMAGE:4100679), complete cds|Mitogen-activated protein kinase kinase 5 [Homo sapiens]
  • Gene Name URL :

    MAP2K5
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC008838

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide