PPP3CC Antibody

CAT:
247-OAAL00255-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PPP3CC Antibody - image 1

PPP3CC Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Protein phosphatase 3 catalytic subunit gamma
  • Gene Aliases :

    Calcineurin, testis-specific catalytic subunit; CALNA3; CAM-PRP catalytic subunit; CNA3; PP2Bgamma; protein phosphatase 3, catalytic subunit, gamma isozyme; serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform.
  • Gene ID :

    5533
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_005596.2
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca (2+) -dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity) .[supplied by OMIM
  • Clonality :

    Monoclonal
  • Clone :

    4D1
  • Type :

    Monoclonal Antibody
  • Sequence :

    MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    PPP3CC
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens protein phosphatase 3 catalytic subunit gamma (PPP3CC), transcript variant 2, mRNA|serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform 2 [Homo sapiens]
  • Gene Name URL :

    PPP3CC
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_005605

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide